DPCstruct | MC36291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 158 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7MX26 | 29-196 | ILQRYFQNITSFSAISSFVRFNIQDPSQFITLYKETDPLESSLYLSSVLITIHYLMSEITKNYSQVDRAWSILPAVYAWHYAIHDYL… |
| A0A3B9AMA3 | 11-148 | ALVVIPLVAFYMDDPLSALQRTMLHTSAWMMLGVAAYCFIVGELTGNNSQVDKLWSVIPIVYAGYFAYAADWEPRVTLMAVLVAVWG… |
| I1C4S9 | 4-161 | None |
| A0A4T0J3P1 | 7-174 | None |
| R7QLE7 | 20-172 | None |
| A0A0F7SIA8 | 39-210 | None |
| A0A4Y9ZKT3 | 9-157 | None |
| A0A812UNJ1 | 336-486 | None |
| A0A196SP24 | 822-995 | None |
| A0A4U0XWW3 | 578-743 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.