DPCstruct | MC36290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 510 ± 41 aa |
| Standard deviation of domain lengths | 41.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812RWG1 | 24-443 | KERQEERVASELYKRFFNADLCEESPDRATIVGNLVGVDVNAVAAVRAIERYQKERRHRFMYLSSSAEHVGDTRTRVLEELKQWLMT… |
| A0A3L6VSV9 | 1-510 | MGLRLNPWGNVYSSLELEQITFVHRVYLETMNIEAKDLPNVLQMNATFTEPVYSPKKPDFDEHTFMRQMQGVVGLLRQPAEEIISCI… |
| A0A813EPM2 | 29-506 | None |
| A0A098G207 | 64-598 | None |
| A0A1G0X3W1 | 57-587 | None |
| A0A1Q4AY73 | 36-567 | None |
| A0A7S4V6D9 | 66-532 | None |
| A0A812SDX1 | 40-569 | None |
| A0A0W0ZB81 | 40-563 | None |
| A0A7S4DTU7 | 1-573 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.