DPCstruct | MC36286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 15.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6SUB4 | 1-103 | MAGSGCPRVSAFIDRVRQKVFESTHTPAAEFEFVYGIHQALHLATGLLHLGWGRCKLKNNALGRAAVLLALWPGYRHDVSDMKYHVQ… |
| A0A5B7EG43 | 2-95 | VMAGTGDLDVLRIVRYLRSRVGPSNSTVGYGSHLTIHMALGFLFLGGGRFSLSTSNMAIAALLIACFPKFPTHSNDNRYHLQALRHL… |
| A0A287FTX2 | 63-142 | None |
| A0A6V7X934 | 306-433 | None |
| A0A7R8XJ24 | 134-213 | None |
| A0A813EYP2 | 4-109 | None |
| A0A2K3NKQ4 | 308-386 | None |
| A0A433QW49 | 47-124 | None |
| A0A5M9JG33 | 1-78 | None |
| A0A2G2YXM6 | 87-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.