DPCstruct | MC36283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 233 ± 39 aa |
| Standard deviation of domain lengths | 39.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.57 |
| Pfam Score | 77.23 |
| Assigned Pfam label(s) | CL0023- CL0020- CL0061- PF00351- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6SP07 | 17-242 | RRFLASMALRRGEEHKKVLTTPAIGVAFTLHDNPGSLVEALNIFSRRGISLSHVSNRCSPLEPYKAMFHVHFRGGWESKETRDVLEE… |
| A0A845X2R6 | 9-236 | SYSLTLRLQLANQPGQLATVINAIASAGGNIGQISLIEQDRYQSVRELVVDTASLDHAERLTAAIKARPEVKLLSATDRTFAIHQGG… |
| A0A820ZBR3 | 25-282 | None |
| A0A158R3G9 | 37-297 | None |
| A0A2P4YQM0 | 567-814 | None |
| A0A1Q7GIV1 | 315-613 | None |
| A0A2W1BRV1 | 32-266 | None |
| A0A507DLU3 | 269-451 | None |
| A0A1D2N4Q6 | 519-776 | None |
| A0A368F9E2 | 2-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.