DPCstruct | MC36282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6SLU8 | 57-149 | GAALNRLTEHFGVDDLEGLLGCLDDNDPLRELRDEFLFPQSLCGDAGDNNKVIYFLGNSLGLMPRRVKELVNRELTKWADLAIEGHF… |
| A0A2K5JSY0 | 10-109 | ADTVQRIATELKCHPMDERVALHLDEVDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAK… |
| A0A2H2ITM2 | 29-118 | None |
| A0A072PW69 | 14-107 | None |
| A0A4Z2EP12 | 72-171 | None |
| A0A3P7FRG0 | 329-435 | None |
| A0A813YCN8 | 26-141 | None |
| A0A444SW69 | 8-94 | None |
| A0A2V5RCZ8 | 6-80 | None |
| A0A672KGV4 | 4-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.