DPCstruct | MC36281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 8.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.88 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0254- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6SL97 | 11-93 | SCKAIVAPSVLAADFAHLARDCDEVLKGGADWLHLDFMDGHFVPNLSFGFPVVESLDKYYKKQESETGHAHPFFDAHIMVSNP |
| A0A376U0Q1 | 1-69 | MKISPSLMCMDLLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQVKKLATKPLDCHLMVTRP |
| A0A212CHN1 | 1-77 | None |
| A0A1S8VKA8 | 3-68 | None |
| A0A4P5YQT1 | 88-156 | None |
| A0A2E3MP15 | 69-143 | None |
| Q91VZ4 | 2-69 | None |
| A0A380JEB0 | 1-72 | None |
| A0A1Q5SRS9 | 4-82 | None |
| A0A2E5Q4U9 | 16-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.