DPCstruct | MC36280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 458 ± 88 aa |
| Standard deviation of domain lengths | 87.56 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6SHS5 | 7-513 | IRDFVDRVYDLLIGDKRMVGYFEGKNLDGIKKAQVVYITALLGGPTAWQGRDLSEIHSGLGIDDYGFDCFTMTCEKALNAMGVDEDT… |
| A0A7S4UQ38 | 19-411 | LEAAVDEFYKRLLADNTLEHFFESISIKELKEHQRKFLRLAFTKIPESIDVEKLMLGKHQRLFLMGLNEKHFDSVATHFVETLQHLG… |
| A0A7J6SJN1 | 120-663 | None |
| A0A7J6RN54 | 3-443 | None |
| A0A6P0V2F5 | 45-720 | None |
| Q22CE3 | 461-833 | None |
| A0A7J6U439 | 24-459 | None |
| Q22F07 | 325-781 | None |
| A0A7J6QBC9 | 2-495 | None |
| C5KZ65 | 71-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.