DPCstruct | MC3628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497C3U3 | 6-148 | HIDPVTRRIYLHSDTVSMQTVNPIDIYKEMRTLRADDESLRPFDVFLSAFGNVSKGGGKFTERYVMENSGTKIIPYDASHTLTINGT… |
| A0A6C0J3K0 | 24-186 | NQKVSFDGANRNIYVAEGVTELNVKTDLYSAWKEWAQFSTESPPPIVWAKAFTAVGGDPITESQDLGTTFFLENGWRIQPTPNGTSY… |
| A0A5C7J4R3 | 4-141 | None |
| A0A497PQN1 | 201-330 | None |
| A0A1G0IA17 | 2-156 | None |
| A0A496WKM8 | 3-120 | None |
| A0A661TN98 | 5-139 | None |
| A0A1V5WXF2 | 869-1036 | None |
| A0A496XFL7 | 5-136 | None |
| A0A661E0X2 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.