DPCstruct | MC36271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1217 |
|---|---|
| Mean domain length (aa) | 120 ± 21 aa |
| Standard deviation of domain lengths | 21.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 92.22 |
| Assigned Pfam label(s) | CL0465- CL0642- CL0033- PF16621- PF16454 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401RSH3 | 19-128 | PAAVADNGGEGGMRWYHGAITRTDAENLLRLCKECSYLIRNSQSKKNDYSLSLKSSQGFMHMKLTRTKDKYILGENSLPFDSVPEII… |
| A0A6I9LCG3 | 10-104 | DRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTT… |
| A0A2B4SRA2 | 56-161 | None |
| A0A7E4VTD4 | 221-343 | None |
| A0A2B4SB06 | 482-605 | None |
| A0A2B4S413 | 764-888 | None |
| A0A7E4VY90 | 116-302 | None |
| A0A0K0DX65 | 288-412 | None |
| A0A7E4VJ62 | 310-426 | None |
| A0A1I8IIT8 | 611-742 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.