DPCstruct | MC36270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 167 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401RR09 | 1-155 | MAHITLNQYLQQVLEFIDSRDGDSCAEFLSFKHPHVANRRLQLASPEERCQQILEPPYDEMVAAHLRCAYAVANHDFVEACKYQTFV… |
| A0A1D2A0Z3 | 7-174 | LVHSINDCINRRNSARLRLLLQVNNSTTQEAVFAARNANPRWDPVAAANRLPEGWAEFLALFWACIVALQEGKRGEAYDKLVAALQP… |
| A0A0J7KCY2 | 3-171 | None |
| B8BF35 | 15-160 | None |
| T1GPU0 | 37-188 | None |
| A0A816GFS3 | 2-205 | None |
| A0A819GAU4 | 249-439 | None |
| A0A0D3H6D0 | 15-183 | None |
| F6THB4 | 8-177 | None |
| A0A1B0B3W3 | 294-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.