DPCstruct | MC3627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 395 ± 44 aa |
| Standard deviation of domain lengths | 43.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0H2V9 | 305-712 | REGSKGKKVLMNLICNHFDKDPLKQRPMPIFIGGPKNLTVHISKKYDKMIYIFGEYHSDKIDCDVRFGDESSKETWDKPNSKKMRVE… |
| A0A6C0IZ03 | 28-408 | KNFFENICSKYQDLKLSAPNSNLTLIKLIQNKIEKRYPKSLHLGGPNQIVVLKSTKYGKNIYCFGEAHSAKTDCPPEHTTVPIEDFL… |
| A0A6C0LYM4 | 95-495 | None |
| A0A6C0LTI7 | 3-387 | None |
| D8LPA9 | 19-322 | None |
| A0A6C0HEY6 | 8-434 | None |
| A0A6C0H3X9 | 31-444 | None |
| A0A6C0H3W0 | 22-460 | None |
| A0A6C0H3E1 | 19-424 | None |
| A0A6C0H390 | 20-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.