DPCstruct | MC36268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 372 ± 37 aa |
| Standard deviation of domain lengths | 36.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.83 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0023- PF11907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R9ZSL5 | 2-346 | RENYTNLKNKLGHIPKLSDFDRYGEMDVLRIFENNSLGSYYKFLVKYEKEYTVRLSEKEEKVIEFICKKLASGKRIHELELLNRMLK… |
| A0A1T4R779 | 6-375 | GQHRKEFQFHRRFGALLGGSRKQLEKQIESGFPFLPSGCHMQLDAVATQTVLENIRQSLPSTWPAKARELQRVAEATPDITLKRFLE… |
| A0A7X6ZGZ7 | 37-421 | None |
| S4MZI6 | 525-905 | None |
| A0A843E2K7 | 1-285 | None |
| A0A7C1C7X8 | 6-303 | None |
| A0A2E3K5S1 | 214-626 | None |
| A0A7X8L5L1 | 266-642 | None |
| A0A7W5DLD3 | 73-447 | None |
| F0I3B3 | 41-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.