DPCstruct | MC36262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 268 ± 27 aa |
| Standard deviation of domain lengths | 26.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836WLM8 | 1-249 | MIPILIIFVLQNEIRLINLLNGLELDSHQRALISELAQTAEDLRDEFESEKEGLESELEPLLEELKRYLLHRKMIPGRLTKSIHKTT… |
| A0A523ZTG3 | 1-294 | MEKGKVSVLWMVLAVFLTAGLLWGLPELSREKLEKTGELRREIRLLNLMNGLDLTQEQMEIILTSAKEYQRLMARFEHILRNSQDKM… |
| A0A660VME6 | 21-308 | None |
| A0A7V5ASN0 | 1-330 | None |
| A0A7C3N573 | 61-322 | None |
| A0A202DDZ8 | 37-300 | None |
| A0A3A4PHQ7 | 264-504 | None |
| A0A3M1I020 | 29-267 | None |
| A0A847LDC7 | 17-274 | None |
| A0A7V3UXU7 | 298-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.