DPCstruct | MC36261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 200 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 12.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0126- PF05488 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523X5N1 | 30-138 | IFSSSGKPAARLGDRTAHGGSIVAGCSTVFICGKPAARVGDMHVCPMMNPTNPPTPHVGGPIVMGSPTVIIGGMPAARVGDMATCSG… |
| A0A645DXT5 | 2-86 | DTGHDACPATELIEGSPNVYINDKPAGRVGDAYAAHGCIDHPSHTGHIASGSSNVFINGKPAGRVGDAVDCGGTVASGSSNVFVG |
| A0A853JG39 | 1-106 | None |
| A0A447WBX4 | 1-100 | None |
| A0A419F4C9 | 61-158 | None |
| B2PWT6 | 5-106 | None |
| A0A6S6Z4E3 | 42-123 | None |
| A0A158DI68 | 1-117 | None |
| A0A2N5CZJ7 | 2-104 | None |
| A0A7C5J0J2 | 19-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.