DPCstruct | MC3626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 199 ± 16 aa |
| Standard deviation of domain lengths | 16.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4P1X4 | 59-253 | TQTISITYGDQAENHVGMQMIGRLSESGFGERELVEAKRKFEEMGGVAELIDLRESSGVKSIQKNADPAFVLVLRKGVDVLLKERGE… |
| A0A6C0IYI9 | 1-200 | MTSTLKNTRIALTFGDAGENHTGMEMVGKLGKEGSGFTKKDLLNIKSHLDKLGYNSHFHSFTLKSVFLGGILIVRNFLGMAEQENLF… |
| A0A139AR31 | 3-190 | None |
| A0A6C0F6Q1 | 349-546 | None |
| A0A6C0H446 | 141-349 | None |
| A0A7S1AYP6 | 3-182 | None |
| A0A6C0J9T5 | 1-236 | None |
| A0A6C0ELZ2 | 2-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.