DPCstruct | MC36258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 194 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7U8D7 | 32-233 | AAYVASRAASRVAADAATGVAHLAQAAPPAREAAYAAARNLVTQSYRKEAGALASIRRLSPAGRAPSLVGEALARLDAGHARDLDAL… |
| A0A523SYU6 | 1-206 | MSRLISRNGLSRLSADYYDCLYQLYQAGEAEKLIEAYKQVLNVIEHSTNREIQAVLSTKVFLKDDLQKKEIESIAENLEKLGTAFRE… |
| A0A3D4B8V2 | 1-182 | None |
| X1T5U0 | 37-245 | None |
| A0A3Q9HS98 | 640-850 | None |
| A0A7Z9Q3F7 | 3-160 | None |
| A0A842P2I8 | 99-307 | None |
| A0A1F5AV93 | 3-183 | None |
| A0A1F5YG12 | 61-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.