DPCstruct | MC36256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 13.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5GXB7 | 15-144 | FAFIAALLFTPFDALANKVKIKRDFIYIDKKKTPLKVEKDDTDTYIFTDTSSGKVFVTASYLFERVDDENSFQWLVLKTDGSSYANE… |
| A0A2E2Y6D1 | 2-112 | KFKYKKGYVFVEKKEVLKLRYSIGYFYVSDMNSGEELMYFRLNDNETPSYFDDDYVKVYFNEWEKEFESKSHHRIIMAQMINEGIFD… |
| A0A7Y0FNX7 | 2-123 | None |
| A0A3N6ZU68 | 14-147 | None |
| A0A345GUF1 | 9-125 | None |
| J2JFV6 | 1-140 | None |
| A0A4Q3SKJ1 | 2-122 | None |
| A0A3D9FKY6 | 1-132 | None |
| A0A7H9DRT7 | 3-117 | None |
| A0A6I4IUC4 | 5-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.