DPCstruct | MC3625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 21.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 18.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0IWX3 | 12-159 | ELPYDGESWNKMGNVQKLNCYDYAWGNANPHQLEFSQPIPRPPNELYTCNNVEKGMMKQHPDAEIIEFEQSCPSGKRKVALVVDDVA… |
| A0A6C0EY35 | 8-174 | SYNKNRYVRESHNCYSYFLNLKSKNAYELCRKELNNNDYCKRSQPGYASKYPRLKTADFSCPNIMKRTLDDNNNSVFRIKKTQTCPR… |
| A0A357IRC2 | 366-519 | None |
| A0A2W1MNB3 | 23-161 | None |
| A0A6C0JEM1 | 24-177 | None |
| A0A1J7I5V7 | 18-140 | None |
| A0A1J7IZD0 | 11-147 | None |
| A0A5J4V3Y1 | 188-336 | None |
| A0A3M8G5R0 | 55-230 | None |
| A0A7V3WL08 | 27-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.