DPCstruct | MC36244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H6PGN8 | 1-101 | MKQPMRPSESDAIEKLEAEIERLKASQKMMRAANTALRKGDDNALRALGFSEEHIGELKTKDFAGRVGFPQSALRNNNADIRRLKKR… |
| A0A2N1D2Z1 | 217-305 | IASDDPQAIKKLRAKLIELEATQTRMKSANKAIKQNDNEALTRLGFNDKTIEALNTEDFAGRTGFASYQLTNNGAEIRRLKKRIESI… |
| A0A7I8CCF2 | 1-85 | None |
| A0A2Z6ILU8 | 712-811 | None |
| A0A538QWS0 | 153-234 | None |
| A0A2N1D366 | 712-802 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.