DPCstruct | MC36239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 257 |
|---|---|
| Mean domain length (aa) | 228 ± 49 aa |
| Standard deviation of domain lengths | 49.12 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 92.53 |
| Assigned Pfam label(s) | CL0214- CL0376- CL0103- CL0482- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381Z3G5 | 250-460 | VGIVLAILNFLHRNLNVGYGWVLIIFGVLMRVLLFPLNQKAMRAQMRNMAVQPLLQEIQKQYKDQPEKLQKEMMKLYKEHGFNPLAG… |
| A0A3T1E246 | 2-107 | IQMPVFIALYWMLLESVELRHAPFIFWIQDLSVKDPYFILPILMGISMFVQQMLNPTPPDPMQAKIMKMLPIIFTFFFLWFPAGLVI… |
| A0A7X8HJG2 | 2-335 | None |
| A0A453DZM5 | 1-219 | None |
| A0A7S2UKI0 | 147-417 | None |
| A0A194UNW9 | 2-306 | None |
| A0A355U5F9 | 120-388 | None |
| A0A4Y7L392 | 102-330 | None |
| A0A5C8EUQ7 | 12-239 | None |
| A0A2W1ULU1 | 106-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.