DPCstruct | MC36238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0W8Q3 | 1-125 | MKINLNKEHAVEAMLKTVNGKAKNFTITTSSHLKSYYVELAEKKLAEVLPKAAWTGATVECRPEGPSSMSYRYSAKSTRCVLKRGAK… |
| A0A7W7Z2M6 | 2-132 | TKIRIDNDNTAALQAALDAVNGKASAFTLRYASTLVHIAARATARLDRLAVPTAERAGTVVSYRTAGPSAKSYNGGRSAIGTAVELT… |
| A0A239MI83 | 66-203 | None |
| Q0F0R9 | 26-148 | None |
| A0A4P5UG00 | 1-131 | None |
| A0A4Y9F5R2 | 1-112 | None |
| A0A1W2F4A8 | 12-130 | None |
| A0A7Y3JD18 | 64-179 | None |
| A0A4P9Z6F9 | 2-123 | None |
| A0A1J5MRL1 | 87-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.