DPCstruct | MC36237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 340 ± 87 aa |
| Standard deviation of domain lengths | 86.83 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 94.74 |
| Assigned Pfam label(s) | PF16547- PF07947- PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3I1M1 | 74-423 | NVILEPDYDNRFVHKACSILKTLCINVVLRREDLTLPWRPVYELYKETVYGRNEKCIDKTILRETILCIKKLFPLPATREILQEIRP… |
| Q5A2T3 | 264-650 | LRVNLARVYYAICLCRGQHVNLKTYIRIFELLTKDQLLLYSHGLRLPWEDLCRELELHFAPIDAGLTIFEKKDHKQLIKLASRANYF… |
| V5DQ01 | 133-491 | None |
| A0A553N0R4 | 91-379 | None |
| A0A3Q0JH44 | 95-483 | None |
| A0A820AE08 | 2-253 | None |
| A0A0D8XVV1 | 152-490 | None |
| A0A183MWF2 | 77-444 | None |
| A0A814KRI4 | 12-414 | None |
| C1GVY2 | 591-1023 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.