DPCstruct | MC36232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 154 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3HW01 | 4-158 | IVFCSGIALALVAGCLYGSTFVPVIYVQDNVEGAPSRGLPYVFAHSMGIFLTSNLLFVGYCIIKKNNPLINNQISLPALCAGCIWIV… |
| A0A7S0JER1 | 245-411 | APEAPPSRAPLPRTLSVKIWGVTLALFAGATCGVNAVPFELWNASRDGSTSPLAFLFSQTLGVYAASSLIYHLVGAAALLSSIELPH… |
| A0A2T7PMH0 | 253-404 | None |
| A0A0M3IHF8 | 1-138 | None |
| A0A183C803 | 229-367 | None |
| A0A812LNH1 | 58-214 | None |
| A0A016VEQ5 | 42-199 | None |
| A0A821Y291 | 93-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.