DPCstruct | MC36231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 18.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3HVW0 | 1-160 | MKGPVDGVHAASDEGLVANPYSRIEDTIERKRRNLEKRKIRLQQYEEDLRNGKKLSEEQQEARSRIGEVETQLEFMKDLMKLLTGLQ… |
| A0A6G0IXA1 | 77-204 | PGSMGNFALGGQSEVLKQVLGVIDKKARNMEKKKSKLDDYQVRKNNGERLNQDQLEALCKYQEIMNNLEFARELHKTFIAMGQDMQK… |
| S9XQ26 | 60-226 | None |
| A0A674IBS1 | 16-168 | None |
| A0A3Q2QAF1 | 41-183 | None |
| A0A0C2M9M1 | 1-181 | None |
| A0A7J7JWC2 | 1-141 | None |
| Q4SRJ2 | 201-379 | None |
| A0A6I9VKJ5 | 71-213 | None |
| A0A0V1NA61 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.