DPCstruct | MC36228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 123 ± 25 aa |
| Standard deviation of domain lengths | 25.30 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.33 |
| Pfam Score | 48.95 |
| Assigned Pfam label(s) | PF01681- PF03436- PF03380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3HSQ9 | 10-148 | NCYTLLHACANTSGWSIPKVDSSRHVSGVRTAVPAKKCNDCQQSNIAVAREDPNNSHTLTPTLLVSTAKTNGCLRLQATCDATASLD… |
| A0A2G9U1L1 | 10-106 | NSPCMKCSEEFYVKPADNKIEGAVYVDYRADRCLSAELYCRPTKNKHYVEILEDGASVGIVGPSLNRTFHCNYDSQWVETKTSAVIA… |
| A0A0N5CQ56 | 70-195 | None |
| A0A2A2K813 | 42-190 | None |
| A0A2G5U0E1 | 21-151 | None |
| A0A0N4WIS1 | 49-162 | None |
| A0A0N4W7F9 | 1-203 | None |
| A0A0N4VWP0 | 4-89 | None |
| A0A0N4VSW2 | 101-199 | None |
| A0A0M3IVF1 | 3-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.