DPCstruct | MC36227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8KD46 | 2-110 | NRKQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLPRKRGAEILPRQFEE… |
| A0A0M3HQD8 | 13-151 | NEHLTPRAPTCILEPAGNVTVGNRTQASPNIQRYFKVPFVHVADRHREGTTNGLIKGGMWYAHFDGQWVARQMEICPNKNPVLLIAG… |
| A0A212C5Z6 | 305-451 | None |
| A0A820SHK4 | 2-102 | None |
| A0A2A2KFV3 | 1-115 | None |
| A0A6S7HAZ3 | 341-459 | None |
| J9BM25 | 28-204 | None |
| F6UYB4 | 20-145 | None |
| A0A183FFF7 | 136-281 | None |
| A0A7R9J0E4 | 382-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.