DPCstruct | MC36226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.11 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0374- PF17297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3HM41 | 9-72 | FQVVHPKKREIWSYGIASESAILCKNEVSLRLASVIAKEEGWLAERMTIIAISGELEHFLTKIF |
| A0A026WDT5 | 90-164 | WPCDPERTIILHNPAKNEIVSYGSGYGGNSLLGKKCFALRIGSTIAKKEGWLAEHMLILGITNPKGKKRYIAAAF |
| A0A7W8J929 | 90-150 | None |
| A0A821SBN0 | 1-70 | None |
| A0A0M3HHN4 | 22-95 | None |
| A0A1I7WNM7 | 72-158 | None |
| A0A822AEA3 | 35-109 | None |
| R0J9Z8 | 72-143 | None |
| A0A0N4YZ23 | 98-172 | None |
| A0A0M3J949 | 2-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.