DPCstruct | MC36225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 50.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3HLW1 | 1-120 | MAELEERVGAIRLKTQSSETVVQEMTRDIKQLDVAKRNLTASIKTLHHLHILLTGVHSLGAWIEQRRYGDIASQLPAVLNVLQLFNS… |
| A0A078F2X3 | 68-182 | ELSYKIQEIKSKAEQSEAMVQEICRDIKKLDFAKKNITTTITALHRLTMLVSAVEQLQVMASKRQYKEAAAQLEAVNQLCNHFEAYR… |
| A0A0L0SWI6 | 1-118 | None |
| A0A446Q7E2 | 1-139 | None |
| A0A817CIE6 | 4-113 | None |
| A0A2B4S5Y3 | 119-240 | None |
| I3L4P9 | 106-202 | None |
| A0A067ESW2 | 1-113 | None |
| M1AZ94 | 71-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.