DPCstruct | MC36223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3HL99 | 1-96 | MFPENIIQATFQQVQTNYVAVKPKVLKASGGNGTSEKPIMKPILEYTNEMNVLGLIVFCTGFGVILSVLGEQARLMINFFIVLDAII… |
| A0A4W4E1Z7 | 166-253 | SFLDLARNLFPSNLVAATFRSYATDYKIIRVGNGTNGTLDYEKVPVGTDSEGMNILGLVMFAMIFGVALRKLGKEGEELIRFFNAFNE |
| A0A6V7VTB9 | 380-483 | None |
| A0A4S2LFM4 | 167-265 | None |
| A0A672KEB0 | 61-156 | None |
| A0A6P8VF87 | 239-332 | None |
| A0A0B1T2S9 | 88-186 | None |
| A0A7R9L418 | 1-90 | None |
| G1T525 | 78-187 | None |
| A0A5J5CR95 | 160-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.