DPCstruct | MC36211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 19 aa |
| Standard deviation of domain lengths | 19.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5CHF6 | 9-222 | RSMPGYRKVFRPHWFATRNFHGQWYADSDRLEALVPFREQSITAHLDEAPQHRSALANWIPKLLPGLVRMRIEGLAKGAGGSLHWFA… |
| R6E997 | 176-396 | LGAFGMGLKDVQDSRMMAKYNFHGHYYTDSDLLDDILHFRCIPADQYWGGVREEMRRMAANPLIRAGFPTAEQMFAHNKEVGGKRMG… |
| A0A417BDN0 | 449-676 | None |
| A0A496RA02 | 259-478 | None |
| A0A497PUV7 | 132-317 | None |
| A0A0H5Q116 | 1-196 | None |
| A0A3A6EKA5 | 905-1125 | None |
| A0A7V6SU97 | 64-286 | None |
| E7NR73 | 2-234 | None |
| A0A850DIY5 | 262-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.