DPCstruct | MC3621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Standard deviation of domain lengths | 25.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.31 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | CL0023- CL0036- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0INI8 | 11-140 | VGLQHGDEGKGKVAHALLNQNDYDYCIRYNGGPNAGHTIQLSHEKSITLHQLPCGVLNKVPSIIGTNCVIDLTRLEAEINEVECALP… |
| A0A0B8PU01 | 4-151 | VIGNGVVLSPEALLKEMKPLEERGIPVRERLFVSEACPLILPYHIAVDQAREIARGKKAIGTTGRGIGPAYEDKVARRGLRVGDLFD… |
| A0A7F8K8H2 | 26-173 | None |
| A0A6J0TWQ5 | 44-220 | None |
| A0A3L7Y5V8 | 136-335 | None |
| A0A7U3BV29 | 1-118 | None |
| A0A424NSH0 | 1-176 | None |
| A0A669CGU4 | 22-132 | None |
| A0A816QG99 | 14-133 | None |
| A0A2A2K597 | 2-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.