DPCstruct | MC36209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 119 ± 3 aa |
| Standard deviation of domain lengths | 2.93 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 47.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2IBD5 | 1-120 | MSLEEAAQTFYGLEEYPWNAAAKSIVYVKSRLSWIFETYTDGGLVSSGQVDQFTTGAYYTYLLEMDDDGTIIGGEWVYKSDDDHPDF… |
| W2HTE0 | 1-120 | MPPEKASQIFYGLQETPWNHDFKRIKNIKSRLSWINERYSDGGVVASDLIENFTVRVDYDYILELDECDNIIGGEWLYESNNNHPDF… |
| A0A225VE89 | 173-292 | None |
| W2YJI0 | 645-764 | None |
| A0A6A3N6Q0 | 215-332 | None |
| K3WTJ2 | 272-392 | None |
| A0A5D6XSX4 | 193-312 | None |
| A0A5D6XPY7 | 133-254 | None |
| A0A6A3JMH2 | 96-208 | None |
| A0A6A3KNS2 | 329-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.