DPCstruct | MC36202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 141 ± 26 aa |
| Standard deviation of domain lengths | 25.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8RCG9 | 6-107 | LTTLKERYPNTEFVLFTTPIAEPLYQEMIKAGRQGDFQRWLRECAQVFGQIYDFTTPNSVTRDLEYFYDASHVYPAVGTWMAHRVSG… |
| M5IQZ9 | 12-183 | ASIKKIESGYMAERKRDEVSRLSYENFIEILTDSHENNVTLDIAISPLHARLLETMDYRVGLDAAWYEWKKQITAVNEEVAKRLGKK… |
| A0A537MXW2 | 75-181 | None |
| A0A1M3A826 | 3-148 | None |
| A0A2G6N9X7 | 3-117 | None |
| A0A1U7IIT0 | 347-498 | None |
| A0A7Y2EQB1 | 2-187 | None |
| R6YHZ0 | 2-112 | None |
| A0A318D6U4 | 19-143 | None |
| A0A411Z8Y0 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.