DPCstruct | MC36200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 67 ± 2 aa |
| Standard deviation of domain lengths | 2.18 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 25.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9E160 | 20-84 | PELHLNAAILEVAEPALLAELAADPRIRRYLLARLSDTVVLVDPGHTRDLESALLDAGHTPKVLR |
| A0A3B9KB61 | 196-260 | IELWQGMALLEVDAAGLLDELFASEETRGLLGRRLSPVLAEVAANQVEALQEVFWQRGYLPALTA |
| A0A7C3BFF5 | 314-385 | None |
| A0A7C7DIE9 | 471-537 | None |
| A0A536DM97 | 455-519 | None |
| A0A7C7QS23 | 8-75 | None |
| A0A6N6JVM4 | 1-65 | None |
| A0A3N5NXR1 | 135-200 | None |
| A0A2E9AE05 | 491-554 | None |
| A0A4S4B9D1 | 34-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.