DPCstruct | MC3620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M9IPP0 | 12-76 | GKCSLPEVGAVAAGKTRDLPFVMVDADGCEVGPVSAYLRDLMLGDVSPLTCRSYGFGLLRWHRLL |
| A0A856N1N5 | 3-81 | NDAPRRDLAALVVPRWGRLVETGDRYEPYRLIDPDGAAVEAVAVYFQELLAAGKAPSTVRSYGMDLLRWWRFLQAVDVS |
| A0A7V3MXR6 | 1-85 | None |
| A0A371XNW3 | 1-87 | None |
| A0A8B4EUU7 | 1-79 | None |
| W7TFT6 | 36-103 | None |
| A0A2R4T9L0 | 5-87 | None |
| A0A1C6T4J8 | 144-211 | None |
| A0A1L9DZW5 | 1-83 | None |
| A0A5R9LF60 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.