DPCstruct | MC362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 96 ± 14 aa |
| Standard deviation of domain lengths | 14.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.22 |
| Pfam Score | 99.24 |
| Assigned Pfam label(s) | CL0036- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6GJN7 | 115-199 | MHAVIDRQKNHGMHFRVLAKTLRLSGGDHVHAGTVVGKLEGDRESTLGFVDLLRDDYVEKTEVVVSFHSRLGLTTRCSTCGFRGY |
| A0A6A5MP32 | 8-97 | QKNNGLHFRVIAKALHLSGGDHIHSGTVVGKLEGEREITLGFVDLLHDDFVEKDRSRGIYFTQDWVSLLGVLPVASGGIHVWHMPAL… |
| A0A5N6PTS6 | 456-543 | None |
| A0A445EET8 | 124-221 | None |
| B9RSB5 | 91-177 | None |
| A0A4S8I8Z0 | 309-378 | None |
| A0A4S8I5Y7 | 214-312 | None |
| A0A1J6IDB3 | 31-127 | None |
| A0A7J9L546 | 32-119 | None |
| A0A7J9LQH1 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.