DPCstruct | MC36198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 15.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6C966 | 1-133 | MIKVYLDWNIMSGMKNNHFPELNSIITNKEKFLLLYSTSHIGDIFASIKNHSEEEQRIIREDLDYITFLTDDLCLVNNSKEVTLSKY… |
| A0A2P8QZ64 | 1-103 | MQYVYLDWNIIQNLKNIPKTNEEKICELFKTIKKLKGKYKFPFSEAHILDLLNSCDSYHKEDLDFLFKISKGFEICIQNDEMFMQKF… |
| A0A1G7EIA4 | 18-154 | None |
| H2CKX1 | 6-120 | None |
| A0A2A5FXD5 | 1-131 | None |
| A0A0Q4G5N7 | 14-165 | None |
| A0A375DUE8 | 1-125 | None |
| A0A3N4PM78 | 1-155 | None |
| A0A1Y0Y2L1 | 1-145 | None |
| I3DP77 | 118-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.