DPCstruct | MC36197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7XQX1 | 2-95 | SGVNDDLNGEEPVRFQTSDGEWCSVVHSLAKWKRWMLWKLRDDGVSGIWCDMRGIRKCEDADVICTSPMHSYQVEQFDWEKVNPSEK… |
| A0A4Y2QGF8 | 46-134 | SGINDDLNGTERPVAFDTKAGISASVIQSLAKWKRLALKKYEFEVYSGLCANLKAIRRDENLGPMHSIYVDQWGWEKVIKEEDRNLA… |
| A0A379W1D3 | 1-89 | None |
| A0A1W9F568 | 11-103 | None |
| K1U8F8 | 4-93 | None |
| A0A6D0M3K8 | 1-72 | None |
| A0A2V2EPF6 | 273-363 | None |
| B7XLK2 | 3-98 | None |
| F7JWX4 | 53-143 | None |
| A0A447RC70 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.