DPCstruct | MC36194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 363 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 23.11 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.67 |
| Pfam Score | 99.75 |
| Assigned Pfam label(s) | CL0254- PF01425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7LJW9 | 8-145 | TAVEARRLIGARGLSPVELVESCIGRIEQWNPHVNAVVTTCYDRARAEARAAEAAVMRGEALPPLHGLPVGIKDLDETEGVRTTYGS… |
| K9IEG3 | 13-148 | QKLVDRELTVTELVSQTLDQIEADQAVLNDFVTINRDEALKQAQAIDEKGVDPDNLWAGIPIAVKDNIVTKGLKTTASSKMLSNFTP… |
| A0A5P1F3N3 | 149-285 | None |
| G0RRP1 | 255-381 | None |
| A0A820L6H4 | 9-97 | None |
| A0A535W2U2 | 2-119 | None |
| A0A0D2Y6F9 | 159-277 | None |
| A0A4Z1IQA5 | 108-221 | None |
| A0A7W3JPW0 | 8-129 | None |
| A0A2R6QQ54 | 81-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.