DPCstruct | MC36192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 236 ± 31 aa |
| Standard deviation of domain lengths | 30.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A135LRV2 | 19-332 | SSLLGGTPGQVRTLSKNRPTSHATVRSIECKSDIDKPGLRAKVCFMTSIETPEEEILVRSLHPSLKDCNSVSVVEGGPVEKPLWLVS… |
| A0A0A2JUI8 | 55-299 | HDQHPTLEEETMVRSLHPALKHCDCVSVVEGGPVRKPVWLVNARGAQNINNTHAAGREIHVLPAQTLPPVSPLGLLMRPVNIERINP… |
| A0A3N4I7B7 | 16-224 | None |
| A0A1J7JLI3 | 47-300 | None |
| F2SU17 | 6-211 | None |
| A0A2H3C3J5 | 14-271 | None |
| A0A2V1D5S8 | 406-645 | None |
| A0A1L9VP81 | 19-222 | None |
| A0A370T9U9 | 62-325 | None |
| A0A059JG56 | 83-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.