DPCstruct | MC36186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814NHL4 | 1-168 | VWDPEATRTISAKSHHQAVDFNIFEGMTCHGVSKVVISNGKVVLEDGNLTVIHGAGRFIETPAFPEYIYSRLQKRDNIKLNKVDREA… |
| A0A4Z2FBQ3 | 37-170 | LWDPDVTKILSAKTHHSNVEYNIFEGLEVRGGPLVVISQGKIVLEEGSVHAAEGSGRFVARKPFPDYVYKRIKARSRLAELRGVPRG… |
| A0A0D7AUC8 | 1-140 | None |
| A0A5J5CBY5 | 1-125 | None |
| S4RG82 | 122-273 | None |
| A0A815K2X6 | 109-280 | None |
| A0A4W5KN89 | 174-336 | None |
| A0A4C1TXM0 | 126-312 | None |
| A0A423T0Z5 | 377-521 | None |
| A0A7J8G6W8 | 241-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.