DPCstruct | MC36180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 265 ± 5 aa |
| Standard deviation of domain lengths | 4.82 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 70.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 40.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5G6V4 | 278-535 | NQPISVLTGIDYWLDNLMSNVPEVVMCYHLDGIVQKYELIKTEDLPNLKESKFSPNLIRDVAQNILSFLKANATKAGHTYWLFKGTN… |
| A0A7I8VJX2 | 285-549 | KPINVLTGIDYWLDNLMCNVPELAMCYHLNGMVQEYTLYKTEEIPNLENSRFRPQVIKNIAQNILMFLKTNATKEGHTYWLFKGETD… |
| A0A3R6VBI8 | 42-307 | None |
| A0A5E4ALE4 | 308-580 | None |
| A0A817ZKM6 | 1-266 | None |
| A0A817HAN6 | 279-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.