DPCstruct | MC3618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 544 ± 41 aa |
| Standard deviation of domain lengths | 40.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0B8N2 | 22-507 | DILYLVGNSGYDAFVFEDLDRFGEVTVFEKLREINTLVNFSKKKHPIRFIYLVRDDLLDPSDRTKFFDYIVVVLPYVDPNNAFDVIR… |
| U6FEG8 | 73-620 | IGWDISTKILNTKLDAKFNTDSKENDKDLFLLYGDELRYYFEKSKVRYLIFEDLDRYNNPLIFQRLRQLNINLNHGEKDRIVFIYTL… |
| A0A3E0VBX4 | 72-617 | None |
| A0A317K053 | 55-663 | None |
| U1QDJ1 | 2-492 | None |
| A0A6G8B067 | 4-557 | None |
| E4PUP5 | 383-917 | None |
| A0A1I4C4W4 | 133-701 | None |
| A0A829CB32 | 3-508 | None |
| A0A2A7QBK3 | 19-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.