DPCstruct | MC36178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HQ29 | 1-108 | MFRNVEPCSGLFDIEIPIVNGDTTAVVIRRLKRFSKDIKPRQVVSLWRYLDPLGGDRKLIGLKNPLENNESIPDSAQFKVDSQTGKI… |
| T1HF84 | 2-158 | AVLNENKSYLLQTLNVEELKLLYTDDASAPENIKQETSPYFPYLKLEPASPGLIVKLINPQPNCPYFKKDVIIKEGFCVSDLKNHLN… |
| A0A6H5GHT4 | 224-381 | None |
| A0A060WP60 | 30-196 | None |
| T0NKQ2 | 760-918 | None |
| A0A1S3IPH0 | 104-264 | None |
| A0A183WLK8 | 1-144 | None |
| A0A821D858 | 389-547 | None |
| A0A183JD75 | 620-784 | None |
| Q9VQR8 | 1023-1182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.