DPCstruct | MC36176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 2.66 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 74.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087YE25 | 2-79 | SLPRTLGELQLYRVLQRANLLAYYETFIQQGGDDVQQLCEAAEEEFLEIMALVGMATKPLHVRRLQKALRDWAANPAL |
| A0A1B0C7B4 | 13-91 | VATSRPSNEAEVQLYRVLQKASLLAYYDTLLEMGGDDVQQLYEAGEEEFLEIMALVGMASKPLHVRRLQKALHEWANNP |
| A0A672KCT0 | 1-79 | None |
| A0A8B6F5T9 | 1-80 | None |
| A0A6A4W2U9 | 2-81 | None |
| A0A151MYK3 | 2-80 | None |
| A0A3Q0FLH5 | 2-76 | None |
| A0A803YS76 | 9-92 | None |
| A0A7I8W3X5 | 2-75 | None |
| A0A498LRB0 | 61-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.