DPCstruct | MC36170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 24 aa |
| Standard deviation of domain lengths | 24.17 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5WQK5 | 54-187 | IPEWESAFRELTEQDCIDYIYNLTINRTYDGYLREKSVINDGLAKIFSDITFEESDSELDHAGDIDYIAKVGDKAIGIQIKPITASA… |
| A0A076LH88 | 25-110 | VLTKTYEGLMLQDAILKKVSGELGGNYRPATIEEEAKGIDGVIIIDDKEIPVSIKSKTYVNQEKHLSEELRGHLIIYEKKKNKIIV |
| M0NQS9 | 71-148 | None |
| A0A7X1GRZ4 | 113-184 | None |
| A0A0G1Y092 | 76-202 | None |
| A0A2T2V6M5 | 1-85 | None |
| A0A831LXD1 | 69-209 | None |
| A0A2R6F4Y9 | 38-110 | None |
| A0A2H6EHJ6 | 4-97 | None |
| A0A256KGR6 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.