DPCstruct | MC3617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3JCD8 | 2-64 | DPPLLYSGQTYRGAGCTDDCSGHEAGYEWAELHGIEDPDDCGGNSYSFIEGCVLYAQERAEEA |
| A0A2D1R9P1 | 25-80 | SAGSYEGYGCTQDCSGHDAGYRWAEDNDLTDPADCGGKSWSFEEGCRSFAEERQEA |
| A0A430E178 | 35-102 | None |
| A0A0Q1AU82 | 5-58 | None |
| A0A2L0WCR3 | 45-101 | None |
| A0A0F9ZHX2 | 110-167 | None |
| A0A1G5FTY1 | 2-59 | None |
| A0A1E4Q5J2 | 8-76 | None |
| A0A439IH32 | 13-72 | None |
| A0A554JA99 | 35-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.