DPCstruct | MC36167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 377 |
|---|---|
| Mean domain length (aa) | 332 ± 80 aa |
| Standard deviation of domain lengths | 80.49 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.83 |
| Pfam Score | 98.80 |
| Assigned Pfam label(s) | CL0517- CL0063- CL0507- CL0077- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1NJH1 | 52-351 | AAQLPIWLGYLALPPYVATTSLPITGAALVLWIGVWKAVDIQMGTAETFNTLPSLALHFMSPVEHRLDAKGNAETAAPFEWARHLRS… |
| A0A538PC63 | 30-303 | GRTGVFVGLCVPILLAPLLVAAHATFARFLASVCSLLIWMKLFDLYLDAERTSKLSWRPLLAFLANWGSMVQRKLSAEQRPPPRENR… |
| A0A395GTU0 | 20-467 | None |
| A0A5C2SSD7 | 70-433 | None |
| A0A1Z5SVY1 | 661-1117 | None |
| K0TLQ9 | 39-377 | None |
| A0A1E7FYI8 | 99-475 | None |
| A0A146HC43 | 541-989 | None |
| A0A5B8MBL5 | 75-549 | None |
| A0A819ZD03 | 20-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.