DPCstruct | MC36165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0XIC1 | 1-79 | LARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKNVFD |
| A0A7S1N5Q9 | 14-110 | PTGGAATMDAGENVMYFARKEQCLALGAQLRTKFKPRMEDFNIYRMFPNGEVQHLHPKDGVFPEKVNSGRAGANQNMRNIGGNVDPA… |
| A0A059B3I6 | 95-185 | None |
| A0A7J6VSU9 | 319-434 | None |
| Q7XYP7 | 101-200 | None |
| A0A086CGT7 | 23-140 | None |
| B4FX51 | 1-95 | None |
| A0A1D8DCB3 | 23-125 | None |
| A0A812P235 | 103-210 | None |
| A0A2J7ZTC6 | 46-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.