DPCstruct | MC36163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4TQH9 | 1-203 | MEKNRRESGLPLPWIHIQPTSGDDDGLLAAQDWASGLDDGTWRGLIGLLEMGGPDNVEAALRILVDRVRGGSAPIPDVIPAPTEGIW… |
| A0A257CZE5 | 58-212 | IMVPGCDNPDPELMALSSVPLAEAERLWQFLRQGGAANAQQLFNCIASHWLQRDYPWGEPQPLPRVGLYHPQLSTPSLSDWQAHWRV… |
| A0A0Q3NW02 | 1-163 | None |
| A0A6G3VQK8 | 1-100 | None |
| A0A2X2VWC1 | 6-172 | None |
| A0A1V3WDB6 | 1-154 | None |
| X8AVP2 | 73-221 | None |
| D9PWQ2 | 12-129 | None |
| A0A3Q9S6P4 | 89-249 | None |
| A0A149TI91 | 6-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.